| InSilicoSpectro documentation | Contained in the InSilicoSpectro distribution. |
InSilicoSpectro::InSilico::IsoelPoint - A class for peptide isoelectric point (pI) prediction
use InSilicoSpectro::InSilico::IsoelPoint;
# create a isoelectric point predictor
my $pi = InSilicoSpectro::InSilico::IsoelPoint->new;
# predict isoelectric point for a peptide
$pi->predict( peptide=>'ACFGDMKWVTFISLLRPLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE' );
# calibrate the predictor
$pi->calibrate( data=>{calseqs=>\@calseqs,caltimes=>\@caltimes,calmodifs=>\@calmodifs},calibrator=>$ec );
InSilicoSpectro::InSilico::IsoelPoint is a class for predicting the isoelectric point of peptides. It gives also a method for calibration of the predictor.
$h contains a hash with parameters.
Predict the isoelectric point.
Calibrate the predictor.
Save current calibrator.
Retrieve a previously saved calibrator.
Set an instance parameter.
Get an instance parameter.
Returns a pointer to an array of available authors param set for a given method (such as as 'iterative')
see InSilicoSpectro/t/InSilico/testIsoelPoint.pl script
InSilicoSpectro::InSilico::ExpCalibrator
InSilicoSpectro::InSilico::RetentionTimer
Copyright (C) 2004-2005 Geneva Bioinformatics www.genebio.com
This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version.
This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details.
You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
Pablo Carbonell, Alexandre Masselot, www.genebio.com
| InSilicoSpectro documentation | Contained in the InSilicoSpectro distribution. |
use strict; use Carp; package InSilicoSpectro::InSilico::IsoelPoint; require Exporter;
our (@ISA, @EXPORT, @EXPORT_OK); @ISA = qw(Exporter); @EXPORT = qw(&getAuthorList); @EXPORT_OK = (); our %authorList=( iterative=>['Lehninger', 'Sillero', 'Rodwell', 'EMBOSS', 'Solomon', 'Patrickios'], ); sub new { my ($pkg,%h)=@_; my $pi={}; bless $pi, $pkg; #### Check Lehninger's values $pi->{pK}{Sillero}= {'Carboxyl'=>3.2,D=>4.0,E=>4.5,'Amino'=>8.2,K=>10.4,R=>12.0,H=>6.4,C=>9.0,Y=>10.0}; # Sillero $pi->{pK}{Rodwell}= {'Carboxyl'=>3.1,D=>3.86,E=>4.25,'Amino'=>8.0,K=>11.5,R=>11.5,H=>6.0,C=>8.33,Y=>10.07}; # Rodwell $pi->{pK}{Lehninger}= # {'Carboxyl'=>3.1,D=>4.4,E=>4.4,'Amino'=>8.0,K=>10.0,R=>12,H=>6.5,C=>8.5,Y=>10.0}; # DTASelect (Lehninger) {'Carboxyl'=>2.34,D=>3.86,E=>4.25,'Amino'=>9.69,K=>10.5,R=>12.4,H=>6.0,C=>8.33,Y=>10.0}; # Lehninger $pi->{pK}{EMBOSS}= {'Carboxyl'=>3.6,D=>3.9,E=>4.1,'Amino'=>8.6,K=>10.8,R=>12.5,H=>6.5,C=>8.5,Y=>10.1}; # EMBOSS $pi->{pK}{Solomon}= {'Carboxyl'=>2.4,D=>3.9,E=>4.3,'Amino'=>9.6,K=>10.5,R=>12.5,H=>6.0,C=>8.3,Y=>10.1}; # Solomon $pi->{pK}{Patrickios}= {'Carboxyl'=>'A',D=>'A',E=>'A',K=>'B',R=>'B','Amino'=>'B',pKa=>4.2,pKb=>11.2}; # Patrickios' method #### Check Lehninger's values $pi->set('method','iterative'); $pi->set('current','Lehninger'); $pi->set('peptide','');# Peptide $pi->set('data',{expseqs=>[],exptimes=>[]});# Experimental data $pi->set('calfile','-');# default file $pi->set('calibrator',InSilicoSpectro::InSilico::ExpCalibrator->new(fitting=>'bypass', expseqs=>[],expdata=>[],prdata=>[]));# new calibrator foreach (keys %h) { $pi->set($_, $h{$_}) } return($pi); } sub predict { my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } return $this->{calibrator}->fit($this->predictor); } sub predictor { my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } my $method=$this->{method}; return $this->$method; } sub Patrickios { # Isoelectric point prediction # Patrickios' formula my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } my $pKa=$this->{pK}{Patrickios}{pKa}; my $pKb=$this->{pK}{Patrickios}{pKb}; my $A=1; # Carboxyl my $B=1; # Amino foreach (split '',$this->{peptide}) { if (exists $this->{pK}{Patrickios}{$_}) { $A++ if $this->{pK}{Patrickios}{$_} eq 'A'; $B++ if $this->{pK}{Patrickios}{$_} eq 'B'; } } my $R=$A/$B; return($pKa - log10((1/2)*((1-$R)/$R)+sqrt((1-$R)*(1-$R)/$R/$R+(4/$R)*10**($pKa-$pKb)))); } sub iterative { # Isoelectric point prediction # Iterative my ($this,%h)=@_; my $charge; my $pH; my $step=0.5; my %count; my @aa; my ($gamma,$last_charge,$error); foreach (split '',$this->{peptide}) { $count{$_}++ if /^[KRHDECY]$/ } $count{'Amino'}=1; $count{'Carboxyl'}=1; $pH=7; $step=3.5; $last_charge=0; $gamma=0.00001; do { $charge=0; foreach (keys %count) { $charge+= $count{$_}*pcharge($this->{pK}{$this->{current}}{$_},$pH) if /^[KRH]$|Amino/; $charge-= $count{$_}*pcharge($pH,$this->{pK}{$this->{current}}{$_}) if /^[DECY]$|Carboxyl/; } ($charge > 0)? ($pH+=$step) : ($pH-=$step); $step/=2; $error=abs($charge-$last_charge); $last_charge=$charge; # print "$pH $charge $error\n"; } until $error < $gamma; return $pH; } sub pcharge { my $val=10**($_[1] - $_[0]); return 1/(1+$val); } sub log10 { my $n = shift; return log($n)/log(10); } sub getAuthorList{ my $m=shift or CORE::die "must provide a method name when getAuthorList()"; return $authorList{$m} || CORE::die "empty author list for method [$m]"; } # ------------------------------- calibrate sub calibrate { my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } my (@prdata,@expdata,@expseqs,@sortaa,%indh,$k); $k=0; for ($k=0;$k<scalar(@{$this->{data}{calseqs}});$k++) { push(@{$this->{data}{prdata}},$this->predictor(peptide=>${$this->{data}{calseqs}}[$k])); } $k=0; foreach (@{$this->{data}{prdata}}) { # Predicted cal. data with the predictor (before calibration) $indh{$k++}=$_;# Assign an index to each prediction } @sortaa= sort {$indh{$a} <=> $indh{$b}} keys %indh;# sort the indexes by predicted values foreach (@sortaa) { push(@prdata,$indh{$_}); push(@expdata,${$this->{data}{caltimes}}[$_]);# populate arrays ordered by predicted values } $this->{calibrator}->train(expdata=>\@expdata,prdata=>\@prdata); } # ------------------------------- write / read xml file with the calibrated values sub write_cal { my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } my $str=''; my $k; $str.=$this->{calibrator}->write_xml(file=>$this->{calfile}); } sub read_cal { my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } $this->{calibrator}->read_xml(file=>$this->{calfile}); $this->{calibrator}->train; } #-------------------------------- getters/setters sub set{ my ($this, $name, $val)=@_; if ((ref($val) eq 'HASH') and defined($this->{$name})) {# Add more fields to the hash $this->{$name}={%{$this->{$name}},%$val}; } else { $this->{$name}=$val; } } sub get{ my ($this, $n)=@_; return $this->{$n}; } 1;