| InSilicoSpectro documentation | Contained in the InSilicoSpectro distribution. |
InSilicoSpectro::InSilico::RetentionTimer::Petritis Prediction of peptide retention time by neural network training
# creates a retention time predictor
my $rt = InSilicoSpectro::InSilico::RetentionTimer::Petritis->new;
# trains the predictor
$rt->learn( data=>{expseqs=>['ELGFQG','HPGDFGADAQAAMSK','LSSPATLNSR','RFIK'],
exptimes=>[1314,1194,1152,1500]},mode=>'verbose',
maxepoch=>100, sqrerror=>1e-3,mode=>'verbose',
nnet=>{learningrate=>0.05},layers=>[{nodes=>20},{nodes=>2},{nodes=>1}] );
# predicts retention time for a peptide
$rt->predict( peptide=>'ACFGDMKWVTFISLLRPLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE' );
# saves the network
$rt->write_xml(confile=>'nnet01.xml');
# retrieves a previously saved network
$rt->read_xml(confile=>'nnet00.xml');
# assigns a calibrator to the predictor
$ec=InSilicoSpectro::InSilico::ExpCalibrator->new( fitting=>'spline' );
# fits the calibrator from expermiental values
$rt->calibrate( data=>{calseqs=>['ELGFQG','HPGDFGADAQAAMSK','LSSPATLNSR','RFIK'],
caltimes=>[1314,1194,1152,1500]},calibrator=>$ec );
# save current calibrator
$rt->write_cal( calfile=>$file );
# retrieve previously saved calibrator
$rt->read_cal ( calfile=>$file );
Predicts HPLC retention time for peptides
%h contains a hash
Trains the network from experimental data given in the arrays (@seqs,@times).
Method used for fitting
Predicts retention time for the peptide
Same as predict() but without experimental fitting
Trains the predictor with experimental data and the chosen fitting method
Method used for fitting
Filter experimental data in $rc->{data} by a cutting threshold of relative prediction error of $pc (in %).
Type of error for filtering.
Saves network into a file
Retrieves a previously saved network
Save current calibrator.
Retrieve a previously saved calibrator.
Set an instance paramter.
Get an instance parameter.
see InSilicoSpectro/t/InSilico/testPetritis.pl script
InSilicoSpectro::InSilico::RetentionTimer
InSilicoSpectro::InSilico::ExpCalibrator
Petritis K, Kangas LJ, Ferguson PL, Anderson GA, Pasa-Tolic L, Lipton MS, Auberry KJ, Strittmatter EF, Shen Y, Zhao R, Smith RD. "Use of artificial neural networks for the accurate prediction of peptide liquid chromatography elution times in proteome analyses". Anal Chem. 2003; 75(5):1039-48.
Copyright (C) 2004-2005 Geneva Bioinformatics www.genebio.com
This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version.
This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details.
You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
Pablo Carbonell, Alexandre Masselot, www.genebio.com
| InSilicoSpectro documentation | Contained in the InSilicoSpectro distribution. |
use strict; package InSilicoSpectro::InSilico::RetentionTimer::Petritis; require Exporter; use Carp; use InSilicoSpectro::InSilico::RetentionTimer; use InSilicoSpectro::InSilico::ExpCalibrator; use File::Basename; use AI::NNFlex::Dataset; use AI::NNFlex::Backprop; use XML::Dumper; our (@ISA, @EXPORT, @EXPORT_OK); @ISA = qw(Exporter InSilicoSpectro::InSilico::RetentionTimer); @EXPORT = qw(); @EXPORT_OK = (); sub new{ my ($pkg,%h)=@_;# pkg: name of the module; h: hash with the rest of parameters my $rt=$pkg->SUPER::new;# Create a reference # Setting of properties $rt->set('confile','-');# default file $rt->set('maxepoch',1000); $rt->set('sqrerror',1e-3); $rt->set('mode','silent'); $rt->set('network',{}); $rt->set('nnet',{}); $rt->set('layers',[{},{},{}]); $rt->set('nnet0',{randomconnections=>0,randomweights=>1,learningrate=>.1, debug=>[],bias=>1,momentum=>0.6}); my %layerdef=(persistentactivation=>0, decay=>0.0, randomactivation=>0, threshold=>0.0,); $rt->set('layers0',[{%layerdef,nodes=>20,activationfunction=>"linear",}, {%layerdef,nodes=>2,activationfunction=>"sigmoid",}, {%layerdef,nodes=>1,activationfunction=>"sigmoid",}]); foreach (keys %h){ $rt->set($_, $h{$_}) } return $rt; } # ------------------------------- predictor sub predict { my ($this,%h)=@_; foreach (keys %h){ $this->set($_, $h{$_}) } return $this->SUPER::predict($this->predictor); } sub predictor { my ($this,%h)=@_; foreach (keys %h){ $this->set($_, $h{$_}) } my $dataset = AI::NNFlex::Dataset->new; $dataset->add([[count_aa($this->{peptide})],[0]]); return(${${$dataset->run($this->{network})}[0]}[0]/$this->{knorm}); } # ------------------------------- learn sub learn { my ($this,%h)=@_; foreach (keys %h){ $this->set($_, $h{$_}) } my ($network,$dataset,$knorm); my ($watcher,$sqrerror)=(0,10); my @expdata=@{$this->{data}{expseqs}};# Sequences my @prdata=@{$this->{data}{exptimes}};# Retention times my @aas=split '','ACDEFGHIKLMNPQRSTVWY'; $network = AI::NNFlex::Backprop->new(%{$this->{nnet0}},%{$this->{nnet}}); for (0..2) { $network->add_layer(%{$this->{layers0}[$_]},%{$this->{layers}[$_]}); } $network->init(); $this->{network}=$network; $dataset = AI::NNFlex::Dataset->new; $this->{knorm}=normdata(\@prdata);# Normalize scale of times # Add data points for (my $k=0;$k<(scalar @expdata);$k++) { $dataset->add([[count_aa($expdata[$k])],[$this->{knorm}*$prdata[$k]]]); } while (($sqrerror>$this->{sqrerror}) and ($watcher<$this->{maxepoch})) { $sqrerror = $dataset->learn($network);# Learning $watcher++; print "Epoch: ",$watcher," SSE: ",$sqrerror,"\n" if ($this->{mode} eq 'verbose'); } } sub normdata { my $tmax=1e-12; foreach (@{$_[0]}) { $tmax=$_ if ($_ > $tmax) } return(1/$tmax); } # ------------------------------- calibrate sub calibrate { my ($this,%h)=@_; foreach (keys %h) { $this->set($_, $h{$_}) } my (@prdata); my $k; for ($k=0;$k<scalar(@{$this->{data}{calseqs}});$k++) { push(@prdata,$this->predictor(peptide=>${$this->{data}{calseqs}}[$k]));# Assign an index to each prediction } $this->set('data',{prdata=>\@prdata}); $this->SUPER::calibrate; } # ------------------------------- Filter data sub filter { my ($this,%h)=@_; foreach (keys %h){ $this->set($_, $h{$_}) } my @error; for(my $m=0;$m<=$#{$this->{data}{expseqs}};$m++) { push(@error,(abs($this->predict(peptide=>${$this->{data}{expseqs}}[$m]) -${$this->{data}{exptimes}}[$m]))); } return $this->SUPER::filter(\@error); } # ------------------------------- write / read xml file with nnet data sub write_xml { my ($this,%h)=@_; foreach (keys %h){ $this->set($_, $h{$_}) } my $dump = new XML::Dumper; $dump->pl2xml( [$this->{network},$this->{knorm}],$this->{confile} ); } sub read_xml_str { my ($this,$str)=@_; my $dump = new XML::Dumper; ($this->{network},$this->{knorm}) = @{$dump->xml2pl( $str )}; } sub read_xml { my ($this,%h)=@_; foreach (keys %h){ $this->set($_, $h{$_}) } my $dump = new XML::Dumper; ($this->{network},$this->{knorm}) = @{$dump->xml2pl( $this->{confile} )}; } # ------------------------------- misc return 1;